FOR LABORATORY RESEARCH USE ONLY — not for human or veterinary use, diagnosis, treatment, or cosmetic application. Buyers must be 21+ and legally permitted to purchase research chemicals in their jurisdiction.Intended-use statement →
LL-37 Wholesale
Human cathelicidin antimicrobial peptide (37 aa) — host-defence peptide research
Product Identity
| CAS Number | 154947-66-7 |
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | ~4,493 Da |
| Sequence | [LL-37, 37 aa] (residues 134–170 of human cathelicidin precursor CAMP, UniProt P49913) |
| Amino Acids | 37 |
| Appearance | White to off-white lyophilized powder |
| Purity | ≥99% by HPLC |
| Solubility | Soluble in sterile water or PBS |
| Storage | 2–8°C, desiccated, protect from light |
| Identification | ESI-MS identity confirmation on each batch |
Available Configurations
| Configuration | Content | Best For |
|---|---|---|
| Standard Kit | 10 mg × 10 vials | Protocol validation; evaluation orders |
| Custom | Custom mg × custom vials | OEM; private-label; protocol-specific |
Research Background
LL-37 is a 37-amino-acid cationic amphipathic peptide derived from the human cathelicidin precursor (CAMP). It is the reference human host-defence peptide and is used in membrane-interaction, antimicrobial-susceptibility and innate-immunity research, where its activity depends strongly on peptide concentration, ionic strength and membrane composition.
Proposed Mechanisms
Research Focus Areas
Structure–activity and membrane-interaction studies
In vitro susceptibility reference peptide
Innate-immune signalling models
Quality Specifications
| Parameter | Method | Criterion |
|---|---|---|
| Purity | HPLC at 214 nm, C18 column | ≥99.0% peak area |
| Identity | ESI-MS | Da |
| Appearance | Visual inspection | White to off-white lyophilized powder |
| Purity assay | Amino acid analysis | ≥80% net peptide |
| Residual moisture | Karl Fischer | ≤3% |
| Solubility | Reconstitution test | Soluble in sterile water or PBS |
Tiered Wholesale Pricing
| Kit size | Code | List price |
|---|---|---|
| 10 mg × 10 vials | 375 | US$93 |
US$93–93 per kit (10 vials), from our published wholesale price list; tiered volume discounts apply (see the tier table) — source:wholesale price list (PDF, updated 2026-08-08).
| Volume | Discount | For |
|---|---|---|
| 1 kit | List price | Evaluation; competitive analysis |
| 5+ kits | 10% off | Initial portfolio expansion |
| 20+ kits | 20% off | Mid-size distributors |
| 50+ kits | 30% off | Regional distributors |
FAQ
What is LL-37?
LL-37 is a 37-amino-acid human cathelicidin-derived host-defence peptide (CAS 154947-66-7), supplied as a laboratory reference peptide.
Is the sequence and precursor documented?
Yes — the page states the full sequence and its position within the human cathelicidin precursor (UniProt P49913). Identity is verified by mass spectrometry per batch.
Why does LL-37 activity vary between experiments?
Because host-defence peptide activity is sensitive to salt concentration, pH, serum content and membrane composition. We therefore publish no fixed potency figure — the relevant analytical data are the purity and identity results on the COA.
What does a kit contain?
10 mg × 10 vials per kit (price-list code 375), lyophilized, with a batch-specific COA.
All products are manufactured for laboratory research purposes only. LL-37 is labeled FOR LABORATORY RESEARCH USE ONLY. Not for human or veterinary use, diagnosis, treatment, prophylaxis or any clinical, cosmetic, dietary or household application. Not a dietary supplement, pharmaceutical ingredient, cosmetic ingredient or approved drug substance. Buyers are responsible for verifying the legal status of importation and possession in their destination country.
Ready to Source LL-37?
Bulk pricing, tiered discounts up to 30%, COA with every order.